PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa04g065790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 260aa    MW: 30644.8 Da    PI: 4.8371
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa04g065790.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.2e-193386356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    + ++f++eq++ Le +Fe++  +  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Csa04g065790.1 33 NQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWK 86
                    6689*************************************************9 PP

2HD-ZIP_I/II124.26.1e-4033124293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ++rr+s+eq+k+LE++Fe+e++Lep++Kv+lareLglqprqva+WFqn+RAR+k+kqlE++y+ L+++yd+l+++ e+L+ke+++L +el++
  Csa04g065790.1  33 NQRRFSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYNILRQNYDNLASQFESLKKEKQALVSELQR 124
                     68**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.47E-181090IPR009057Homeodomain-like
PROSITE profilePS5007117.3782888IPR001356Homeobox domain
SMARTSM003897.0E-163192IPR001356Homeobox domain
CDDcd000862.04E-143189No hitNo description
PfamPF000463.6E-163386IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-183495IPR009057Homeodomain-like
PRINTSPR000317.9E-65968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000317.9E-66884IPR000047Helix-turn-helix motif
PfamPF021831.3E-1588129IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MTEGKEYSPA MISSDPFMSM KKMKKSNVHN KNNQRRFSDE QIKSLEMMFE SETRLEPRKK  60
VQLARELGLQ PRQVAIWFQN KRARWKSKQL ETEYNILRQN YDNLASQFES LKKEKQALVS  120
ELQRLNEEML HQTKEEERQC CGDQAVVALS STDHESENEE NHPRCEPEEV RPEMEMYDEK  180
GHHGGLCDHH DHDDEDGYNS NIKREEYFGG FEEEPDHLMN IVEPADSCLT SSDDWRGFKS  240
DTSLLHQSSS NYPWWDFWS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0458260.0AY045826.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-7 (At2g46680) mRNA, complete cds.
GenBankAY0913640.0AY091364.1 Arabidopsis thaliana putative homeodomain transcription factor protein ATHB-7 (At2g46680) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010506683.10.0PREDICTED: homeobox-leucine zipper protein ATHB-7-like
SwissprotP468971e-162ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLR0HUH21e-159R0HUH2_9BRAS; Uncharacterized protein
STRINGAT2G46680.11e-159(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24982874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-147homeobox 7